Teriparatide
Also called Forteo, PTH(1-34)
Subcutaneous (under the skin)Product label
Research reference
Product label
Teriparatide ready-filled device
20 mcg once daily using the supplied device
Course individualized; beyond 2 lifetime years only when high fracture risk remains or returns
Teriparatide product label ↗When results may show
- When change was measured
- Bone health, calcium and adverse effects require clinical review. The pen's 28 daily doses are a device supply, not the whole course.
- When to assess
- Course individualized; beyond 2 lifetime years only when high fracture risk remains or returns
- Conditions and limitations
- Specified adults with osteoporosis at high fracture risk. Exact ready-filled product only; do not mix, transfer to another pen, or copy this schedule into an unidentified powder vial.
- When to stop
- Use the exact product's clinical monitoring and stopping instructions. A supply interval is not a stop date; severe or persistent reactions need prompt clinical review.
Sources: Teriparatide product label
Research timing is descriptive, not a promise or personal instruction. A severe or persistent reaction needs prompt clinical review. This is not medical advice.
Key properties
- Formula
- C181H291N55O51S2
- Mol. weight
- 4,117.8 Da
- CAS
- 52232-67-4
- PubChem CID
- 16133850
Sequence (one-letter)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
External references
Vial arithmetic
Published research contexts for Teriparatide describe 20–40 mcg per administration. Descriptive only, not a recommendation.
Modelled level — every day
1× is the peak after a single dose.
- Steady-state peak
- 1.00× single dose
- Time to steady state
- 5hours
- Administrations
- 7/ week
Read off the modelled curve, not an even-interval formula
About five half-lives
Where these numbers come from
- Teriparatide product labelExact ready-filled product only; do not mix, transfer to another pen, or copy this schedule into an unidentified powder vial.
Next steps
Teriparatide beginner guideOpen Teriparatide planning worksheetEstimate Teriparatide vial costTrack Teriparatide notes